PDB entry 2iyw

View 2iyw on RCSB PDB site
Description: shikimate kinase from mycobacterium tuberculosis in complex with mgatp, open lid (conf. b)
Class: transferase
Keywords: aromatic amino acid biosynthesis, p-loop kinase, metal-binding, shikimate kinase, shikimate pathway, nucleotide-binding, amino-acid biosynthesis, kinase, magnesium, transferase, ATP-binding
Deposited on 2006-07-22, released 2006-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.163
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2iywa1
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iywA (A:)
    mapkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrri
    eedvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrpll
    agpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaatlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iywA (A:)
    apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
    edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
    gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaatleh