PDB entry 2iys

View 2iys on RCSB PDB site
Description: shikimate kinase from mycobacterium tuberculosis in complex with shikimate, open lid (conf. a)
Class: transferase
Keywords: transferase, aromatic amino acid biosynthesis, p-loop kinase, metal- binding, shikimate kinase, shikimate pathway, nucleotide- binding, amino-acid biosynthesis, kinase, magnesium, ATP-binding
Deposited on 2006-07-21, released 2006-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.178
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Z2 (Start-175)
    • PDB 2IYS
    Domains in SCOPe 2.07: d2iysa_
  • Heterogens: SKM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iysA (A:)
    mapkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrri
    eedvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrpll
    agpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaatlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iysA (A:)
    apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
    edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
    gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaat