PDB entry 2iyr

View 2iyr on RCSB PDB site
Description: shikimate kinase from mycobacterium tuberculosis in complex with shikimate
Class: transferase
Keywords: transferase, aromatic amino acid biosynthesis, kinase, magnesium, p-loop kinase, metal-binding, shikimate kinase, shikimate pathway, nucleotide-binding, amino-acid biosynthesis, ATP-binding
Deposited on 2006-07-21, released 2006-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.169
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iyra_
  • Chain 'B':
    Compound: Shikimate kinase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iyrb_
  • Heterogens: SKM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iyrA (A:)
    mapkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrri
    eedvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrpll
    agpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaatlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iyrA (A:)
    apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
    edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntagpdra
    ekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iyrB (B:)
    mapkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrri
    eedvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrpll
    agpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvpspseaatlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iyrB (B:)
    apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
    edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvllagp
    draekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvps