PDB entry 2iyp

View 2iyp on RCSB PDB site
Description: product rup
Class: oxidoreductase
Keywords: oxidoreductase, 6-phosphogluconate dehydrogenase, nadp, pentose shunt, gluconate utilization
Deposited on 2006-07-21, released 2007-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.182
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYP
    • Uniprot P96789 (1-End)
    Domains in SCOPe 2.05: d2iypa1, d2iypa2
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYP (0-0)
    • Uniprot P96789 (1-End)
    Domains in SCOPe 2.05: d2iypb1, d2iypb2
  • Chain 'C':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2iypc1, d2iypc2
  • Heterogens: NAP, 5RP, A2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iypA (A:)
    hmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktlee
    fvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsg
    infigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymganga
    ghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkev
    lkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykderv
    kaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtia
    qiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtp
    iptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyted
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iypA (A:)
    maqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleef
    vgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgi
    nfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgangag
    hyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkevl
    krkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykdervk
    askvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtiaq
    iwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtpi
    ptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iypB (B:)
    hmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktlee
    fvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsg
    infigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymganga
    ghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkev
    lkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykderv
    kaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtia
    qiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtp
    iptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyted
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iypB (B:)
    hmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktlee
    fvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsg
    infigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymganga
    ghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkev
    lkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykderv
    kaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtia
    qiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtp
    iptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iypC (C:)
    hmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktlee
    fvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsg
    infigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymganga
    ghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkev
    lkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykderv
    kaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtia
    qiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtp
    iptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyted
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iypC (C:)
    aqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleefv
    gslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgin
    figtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgangagh
    yvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkevlk
    rkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykdervka
    skvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtiaqi
    wragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtpip
    tftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt