PDB entry 2iyo

View 2iyo on RCSB PDB site
Description: structural characterization of a bacterial 6pdh reveals aspects of specificity, mechanism and mode of inhibition
Class: oxidoreductase
Keywords: oxidoreductase, 6-phosphogluconate dehydrogenase, nadp, pentose shunt, gluconate utilization
Deposited on 2006-07-21, released 2007-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.162
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2iyoa1, d2iyoa2
  • Heterogens: 6PG, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iyoA (A:)
    maqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleef
    vgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgi
    nfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgangag
    hyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkevl
    krkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykdervk
    askvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtiaq
    iwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtpi
    ptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyted
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iyoA (A:)
    maqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleef
    vgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgi
    nfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgangag
    hyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkevl
    krkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykdervk
    askvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtiaq
    iwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtpi
    ptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt