PDB entry 2iyl

View 2iyl on RCSB PDB site
Description: Structure of an FtsY:GDP complex
Class: cell cycle
Keywords: inner membrane, ribonucleoprotein, nucleotide-binding, signal recognition particle, srp, GDP, ffh, ftsy, gtpase, RNA-binding, GTP-binding, cell division, membrane, cell cycle
Deposited on 2006-07-18, released 2007-01-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cell division protein ftsy
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iyld1, d2iyld2
  • Heterogens: GDP, SO4, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iylD (D:)
    aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepde
    rratlrklgfnpqkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdt
    fraaggtqlsewgkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkh
    nlmeelkkvkraiakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgt
    akggvlipivrtlkvpikfvgvgegpddlqpfdpeafvealled
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iylD (D:)
    aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlepda
    tlrklgfnpqkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdttqlse
    wgkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkr
    aiakadpeepkevwlvldavtgqleqakkfheavgltgvivtkldgtakggvlipivrtl
    kvpikfvgvgegpddlqpfdpeafvealled