PDB entry 2iyd

View 2iyd on RCSB PDB site
Description: senp1 covalent complex with sumo-2
Class: hydrolase
Keywords: protease, hydrolase, thiol protease, nuclear protein, ubl conjugation pathway
Deposited on 2006-07-14, released 2006-08-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.273
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (175-225)
    • PDB 2IYD (174-174)
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2iydb1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iydB (B:)
    ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
    qlemededtidvfqqqtggvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iydB (B:)
    ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
    qlemededtidvfqqqtgg