PDB entry 2iyc

View 2iyc on RCSB PDB site
Description: senp1 native structure
Class: hydrolase
Keywords: protease, hydrolase, thiol protease, nuclear protein, ubl conjugation pathway
Deposited on 2006-07-14, released 2006-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (175-225)
    • PDB 2IYC (174-174)
    Domains in SCOPe 2.06: d2iyca_
  • Chain 'B':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (175-225)
    • PDB 2IYC (174-174)
    Domains in SCOPe 2.06: d2iycb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iycA (A:)
    efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
    merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
    vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
    ngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iycB (B:)
    efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
    merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
    vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
    ngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll