PDB entry 2iyb

View 2iyb on RCSB PDB site
Description: structure of complex between the 3rd lim domain of tes and the evh1 domain of mena
Class: metal-binding
Keywords: zinc, lim domain, sh3-binding, coiled coil, tumour supressor lim domain evh1 domain cell motility, phosphorylation, alternative splicing, cytoskeleton, actin-binding, metal-binding
Deposited on 2006-07-14, released 2007-10-16
The last revision prior to the SCOP 1.75 freeze date was dated 2008-01-22, with a file datestamp of 2008-01-18.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein enabled homolog
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYB (0-0)
    • Uniprot Q8N8S7 (1-113)
    Domains in SCOP 1.75: d2iyba1
  • Chain 'B':
    Compound: Protein enabled homolog
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYB
    • Uniprot Q8N8S7 (1-113)
    Domains in SCOP 1.75: d2iybb1
  • Chain 'C':
    Compound: Protein enabled homolog
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYB
    • Uniprot Q8N8S7 (Start-113)
    Domains in SCOP 1.75: d2iybc1
  • Chain 'D':
    Compound: Protein enabled homolog
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYB
    • Uniprot Q8N8S7 (Start-113)
    Domains in SCOP 1.75: d2iybd1
  • Chain 'E':
    Compound: testin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: testin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: testin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: testin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iybA (A:)
    rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iybB (B:)
    rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iybB (B:)
    mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
    ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iybC (C:)
    rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iybC (C:)
    seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
    caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iybD (D:)
    rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iybD (D:)
    seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
    caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.