PDB entry 2iyb

View 2iyb on RCSB PDB site
Description: Structure of complex between the 3rd LIM domain of TES and the EVH1 domain of Mena
Class: metal-binding
Keywords: lim domain, sh3-binding, tumour supressor lim domain evh1 domain cell motility, phosphorylation, cytoskeleton, actin-binding, metal-binding
Deposited on 2006-07-14, released 2007-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYB (0-0)
    • Uniprot Q8N8S7 (1-113)
    Domains in SCOPe 2.08: d2iyba2, d2iyba3
  • Chain 'B':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYB
    • Uniprot Q8N8S7 (1-113)
    Domains in SCOPe 2.08: d2iybb_
  • Chain 'C':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYB
    • Uniprot Q8N8S7 (Start-113)
    Domains in SCOPe 2.08: d2iybc_
  • Chain 'D':
    Compound: Protein enabled homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IYB
    • Uniprot Q8N8S7 (Start-113)
    Domains in SCOPe 2.08: d2iybd_
  • Chain 'E':
    Compound: testin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: testin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: testin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: testin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iybA (A:)
    rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iybB (B:)
    rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iybB (B:)
    mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
    ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iybC (C:)
    rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iybC (C:)
    seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
    caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iybD (D:)
    rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
    incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iybD (D:)
    seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
    caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.