PDB entry 2iy6

View 2iy6 on RCSB PDB site
Description: 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound citrate
Class: oxidoreductase
Keywords: oxidoreductase, 1-pyrroline-5-carboxylate, citrate, dehyrogenase, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2006-07-13, released 2006-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.14
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iy6a_
  • Chain 'B':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iy6b_
  • Heterogens: FLC, MPD, MRD, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iy6A (A:)
    mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
    psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
    vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
    apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
    eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggkdaiivdet
    adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
    gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
    pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
    gvqpfggfklsgtnaktgaldylrlflemkavaerf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iy6B (B:)
    mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
    psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
    vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
    apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
    eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggkdaiivdet
    adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
    gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
    pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
    gvqpfggfklsgtnaktgaldylrlflemkavaerf