PDB entry 2iy5

View 2iy5 on RCSB PDB site
Description: phenylalanyl-tRNA synthetase from thermus thermophilus complexed with tRNA and a phenylalanyl-adenylate analog
Class: ligase
Keywords: class II aminoacyl-tRNA synthetase, ligase, rbd domin, magnesium, sh3 domain, phenylalanyl-tRNA synthetase, thermus thermophilus, protein biosynthesis, metal-binding, nucleotide-binding, RNA-binding, ATP-binding, tRNA-binding, helix-turn-helix motif, aminoacyl-tRNA synthetase
Deposited on 2006-07-12, released 2006-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.238
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanyl-tRNA synthetase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iy5a1, d2iy5a2
  • Chain 'B':
    Compound: phenylalanyl-tRNA synthetase beta chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27002 (0-End)
      • conflict (466)
      • conflict (486)
      • conflict (628)
    Domains in SCOPe 2.06: d2iy5b1, d2iy5b2, d2iy5b3, d2iy5b4, d2iy5b5, d2iy5b6
  • Chain 'T':
    Compound: trnaphe
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
  • Heterogens: FYA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iy5A (A:)
    mleealaaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaa
    leaalearekaleeaalkealerervdvslpgaslfsgglhpitlmerelveifralgyq
    avegpeveseffnfdalnipehhpardmwdtfwltgegfrlegplgeevegrlllrthts
    pmqvrymvahtppfrivvpgrvfrfeqtdatheavfhqleglvvgegiamahlkgaiyel
    aqalfgpdskvrfqpvyfpfvepgaqfavwwpeggkwlelggagmvhpkvfqavdayrer
    lglppayrgvtgfafglgverlamlrygipdiryffggrlkfleqfkgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy5A (A:)
    leelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaaleaalearekalee
    aalkealerervdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnf
    dalnipehhpardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppf
    rivvpgrvfrfeqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfq
    pvyfpfvepgaqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfa
    fglgverlamlrygipdiryffggrlkfleqfkgvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iy5B (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariegyetiplalpaff
    papdnraveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaeafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    gldtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy5B (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariegyetiplalpaff
    papdnraveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaeafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    g
    

  • Chain 'T':
    No sequence available.