PDB entry 2iy3

View 2iy3 on RCSB PDB site
Description: Structure of the E. Coli Signal Regognition Particle
Class: RNA-binding
Keywords: RNA-binding, RNA-binding protein complex, signal recognition particle
Deposited on 2006-07-12, released 2006-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle protein,Signal recognition particle 54 kDa protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: srp54, SULA_1982, SULB_1983, SULC_1981
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iy3a1, d2iy3a2
  • Chain 'B':
    Compound: 4.5s RNA
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'C':
    Compound: signal sequence
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IY3 (0-16)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iy3A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdiesi
    lekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipglgimlp
    tpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveevrellew
    ynnmnrllkmvk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.