PDB entry 2iy0

View 2iy0 on RCSB PDB site
Description: senp1 (mutant) sumo1 rangap
Class: hydrolase/activator complex
Keywords: protease, hydrolase, ubiquitin, thiol protease, leucine-rich repeat, ubl conjugation pathway, protein protein complex, gtpase activation, hydrolase/activator complex ubl conjugation, nuclear protein, phosphorylation
Deposited on 2006-07-11, released 2006-08-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: 0.23004
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (175-225)
      • engineered mutation (184)
    • PDB 2IY0 (174-174)
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2iy0b1
  • Chain 'C':
    Compound: ran gtpase-activating protein 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iy0B (B:)
    eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
    lgmeeedvievyqeqtgghstv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy0B (B:)
    iklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkelg
    meeedvievyqeqtgg
    

  • Chain 'C':
    No sequence available.