PDB entry 2ixt

View 2ixt on RCSB PDB site
Description: sphericase
Class: hydrolase
Keywords: serine protease, subtilisin like protease, hydrolase
Deposited on 2006-07-11, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 0.8 Å
R-factor: 0.138
AEROSPACI score: 1.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 36kda protease
    Species: BACILLUS SPHAERICUS [TaxId:1421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ixta_
  • Chain 'B':
    Compound: 36kda protease
    Species: BACILLUS SPHAERICUS [TaxId:1421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ixtb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ixtA (A:)
    rasqqipwgikaiynndtltsttggsginiavldtgvntshpdlvnnveqckdftgattp
    innsctdrnghgthvagtaladggsdqagiygvapdadlwaykvlldsgsgysddiaaai
    rhaadqatatgtktiismslgssannslissavnyayskgvlivaaagnsgysqgtigyp
    galpnaiavaalenvqqngtyrvadyssrgyistagdyviqegdieisapgssvystwyn
    ggyntisgtsmatphvsglaakiwaenpslsntqlrsnlqeraksvdikggygaaigddy
    asgfgfarvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixtA (A:)
    rasqqipwgikaiynndtltsttggsginiavldtgvntshpdlvnnveqckdftgattp
    innsctdrnghgthvagtaladggsdqagiygvapdadlwaykvlldsgsgysddiaaai
    rhaadqatatgtktiismslgssannslissavnyayskgvlivaaagnsgysqgtigyp
    galpnaiavaalenvqqngtyrvadyssrgyistagdyviqegdieisapgssvystwyn
    ggyntisgtsmatphvsglaakiwaenpslsntqlrsnlqeraksvdikggygaaigddy
    asgfgfarv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ixtB (B:)
    rasqqipwgikaiynndtltsttggsginiavldtgvntshpdlvnnveqckdftgattp
    innsctdrnghgthvagtaladggsdqagiygvapdadlwaykvlldsgsgysddiaaai
    rhaadqatatgtktiismslgssannslissavnyayskgvlivaaagnsgysqgtigyp
    galpnaiavaalenvqqngtyrvadyssrgyistagdyviqegdieisapgssvystwyn
    ggyntisgtsmatphvsglaakiwaenpslsntqlrsnlqeraksvdikggygaaigddy
    asgfgfarvq