PDB entry 2ixr

View 2ixr on RCSB PDB site
Description: bipd of burkholderia pseudomallei
Class: toxin
Keywords: burkholderia pseudomallei, toxin, bipd, ttss, t3ss, type 3 secretion system
Deposited on 2006-07-10, released 2006-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: membrane antigen
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:28450]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ixra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ixrA (A:)
    gsaltvrdwpalealaktmpadagaramtdddlraagvdrrvpeqklgaaidefaslrlp
    dridgrfvdgrranltvfddarvavrgharaqrnllerletellggtldtagdeggiqpd
    pilqglvdvigqgksdidayativegltkyfqsvadvmsklqdyisakddknmkidggki
    kaliqqvidhlptmqlpkgadiarwrkelgdavsisdsgvvtinpdklikmrdslppdgt
    vwdtaryqawntafsgqkdniqndvqtlvekyshqnsnfdnlvkvlsgaistltdtaksy
    lqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixrA (A:)
    amtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavr
    gharaqrnllerletellqpdpilqglvdvigqgksdidayativegltkyfqsvadvms
    klqdyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrkelgdavsisdsg
    vvtinpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqtlvekyshqnsnf
    dnlvkvlsgaistltd