PDB entry 2ixq

View 2ixq on RCSB PDB site
Description: the solution structure of the invasive tip complex from afa-dr fibrils
Class: cell adhesion
Keywords: ig-like domain, afimbrial sheath, structural protein, donor strand complemented, cell adhesion, daf, afae, upec, daec, fimbria
Deposited on 2006-07-10, released 2006-09-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein afaD
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47038 (0-121)
      • conflict (0)
    • PDB 2IXQ (123-End)
    Domains in SCOPe 2.01: d2ixqa1
  • Chain 'B':
    Compound: afimbrial adhesin afa-III
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ixqb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ixqA (A:)
saelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgr
helrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvp
qednkqgftpsgttgttkltvt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ixqB (B:)
eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
wakdnkqgftpsgttgttkltvt