PDB entry 2ixn

View 2ixn on RCSB PDB site
Description: crystal structure of the pp2a phosphatase activator ypa2 ptpa2
Class: isomerase
Keywords: pp2a phosphatase activator prolyl isomerase ptpa, isomerase
Deposited on 2006-07-09, released 2006-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein phosphatase 2a activator 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ixna1
  • Chain 'B':
    Compound: serine/threonine-protein phosphatase 2a activator 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ixnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ixnA (A:)
    mlpekrlltpddmklweesptrahftkfiidlaesvkghensqykepisesinsmmnlls
    qikditqkhpvikdadssrfgkvefrdfydevsrnsrkilrsefpsltdeqleqlsiyld
    eswgnkrridygsghelnfmcllyglysygifnlsndstnlvlkvfieylkimriletky
    wlepagshgvwglddyhflpflfgafqltthkhlkpisihnnelvemfahrylyfgciaf
    inkvkssaslrwhspmlddisgvktwskvaegmikmykaevlsklpimqhfyfseflpcp
    dgvshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixnA (A:)
    pekrlltpddmklweesptrahftkfiidlaesvkghensqykepisesinsmmnllsqi
    kditqkhpvikrfgkvefrdfydevsrnsrkilrsefpsltdeqleqlsiyldeswgnkr
    ridygsghelnfmcllyglysygifnlsndstnlvlkvfieylkimriletkywlepags
    hgvwglddyhflpflfgafqltthkhlkpisihnnelvemfahrylyfgciafinkvkss
    aslrwhspmlddisgvktwskvaegmikmykaevlsklpimqhfyfseflpc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ixnB (B:)
    mlpekrlltpddmklweesptrahftkfiidlaesvkghensqykepisesinsmmnlls
    qikditqkhpvikdadssrfgkvefrdfydevsrnsrkilrsefpsltdeqleqlsiyld
    eswgnkrridygsghelnfmcllyglysygifnlsndstnlvlkvfieylkimriletky
    wlepagshgvwglddyhflpflfgafqltthkhlkpisihnnelvemfahrylyfgciaf
    inkvkssaslrwhspmlddisgvktwskvaegmikmykaevlsklpimqhfyfseflpcp
    dgvshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixnB (B:)
    pekrlltpddmklweesptrahftkfiidlaesvkghensqykepisesinsmmnllsqi
    kditqkhpviksrfgkvefrdfydevsrnsrkilrsefpsltdeqleqlsiyldeswgnk
    rridygsghelnfmcllyglysygifnlsndstnlvlkvfieylkimriletkywlepag
    sglddyhflpflfgafqltthkhlkpisihnnelvemfahrylyfgciafinkvkslrwh
    spmlddisgvktwskvaegmikmykaevlsklpimqhfyfseflpc