PDB entry 2ixd

View 2ixd on RCSB PDB site
Description: Crystal structure of the putative deacetylase BC1534 from Bacillus cereus
Class: hydrolase
Keywords: hexamer, deacetylase, rossmann fold, zinc-dependent metalloenzyme, hydrolase
Deposited on 2006-07-07, released 2007-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lmbe-related protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81FP2 (Start-233)
    • PDB 2IXD
    Domains in SCOPe 2.06: d2ixda_
  • Chain 'B':
    Compound: lmbe-related protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ixdb_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ixdA (A:)
    msglhilafgahaddveigmagtiakytkqgyevgicdlteadlssngtielrkeeakva
    arimgvktrlnlampdrglymkeeyireivkvirtykpklvfapyyedrhpdhancaklv
    eeaifsagirkympelsphrvesfynymingfhkpnfcidiseylsikvealeayesqfs
    tgsdgvktpltegyvetviarekmfgkevgvlyaegfmskkpvllhadllggcklghhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixdA (A:)
    sglhilafgahaddveigmagtiakytkqgyevgicdlteadlssngtielrkeeakvaa
    rimgvktrlnlampdrglymkeeyireivkvirtykpklvfapyyedrhpdhancaklve
    eaifsagirkympelsphrvesfynymingfhkpnfcidiseylsikvealeayesqfst
    gsdgvktpltegyvetviarekmfgkevgvlyaegfmskkpvllhadllggck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ixdB (B:)
    msglhilafgahaddveigmagtiakytkqgyevgicdlteadlssngtielrkeeakva
    arimgvktrlnlampdrglymkeeyireivkvirtykpklvfapyyedrhpdhancaklv
    eeaifsagirkympelsphrvesfynymingfhkpnfcidiseylsikvealeayesqfs
    tgsdgvktpltegyvetviarekmfgkevgvlyaegfmskkpvllhadllggcklghhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixdB (B:)
    sglhilafgahaddveigmagtiakytkqgyevgicdlteadlssngtielrkeeakvaa
    rimgvktrlnlampdrglymkeeyireivkvirtykpklvfapyyedrhpdhancaklve
    eaifsagirkympelsphrvesfynymingfhkpnfcidiseylsikvealeayesqfst
    gsdgvktpltegyvetviarekmfgkevgvlyaegfmskkpvllhadllgg