PDB entry 2ixc

View 2ixc on RCSB PDB site
Description: rmlc m. tuberculosis with dtdp-rhamnose
Class: isomerase
Keywords: isomerase, lipopolysaccharide biosynthesis, epimerise, epimerase, epimerize
Deposited on 2006-07-07, released 2006-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.154
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase rmlc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ixca_
  • Chain 'B':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase rmlc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ixcb_
  • Chain 'C':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase rmlc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ixcc_
  • Chain 'D':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase rmlc
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ixcd_
  • Heterogens: TRH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ixcA (A:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigemrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixcA (A:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfige
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ixcB (B:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigemrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixcB (B:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfige
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ixcC (C:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigemrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixcC (C:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfige
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ixcD (D:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigemrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ixcD (D:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfige