PDB entry 2ix9

View 2ix9 on RCSB PDB site
Description: respective role of protein folding and glycosylation in the thermal stability of recombinant feruloyl esterase a
Class: hydrolase
Keywords: hydrolase, xylan degradation, feruloyl esterase ec 3.1.1.73, glycoprotein, serine esterase
Deposited on 2006-07-07, released 2006-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.155
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: feruloyl esterase a
    Species: ASPERGILLUS NIGER [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42807 (0-259)
      • conflict (202-203)
    Domains in SCOPe 2.07: d2ix9a_
  • Chain 'B':
    Compound: feruloyl esterase a
    Species: ASPERGILLUS NIGER [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42807 (0-259)
      • conflict (202-203)
    Domains in SCOPe 2.07: d2ix9b_
  • Heterogens: CXS, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ix9A (A:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ix9B (B:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactw