PDB entry 2ix4

View 2ix4 on RCSB PDB site
Description: Arabidopsis thaliana mitochondrial beta-ketoacyl ACP synthase hexanoic acid complex
Class: transferase
Keywords: beta-ketoacyl-(acyl carrier protein) synthase, lipid metabolism, condensing enzyme, fatty acid elongation, fatty acid biosynthesis, lipid synthesis, transit peptide, acyltransferase, synthase, transferase, acyl complex, mitochondrion
Deposited on 2006-07-06, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ix4a1, d2ix4a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ix4b1, d2ix4b2
  • Heterogens: 6NA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ix4A (A:)
    rrvvvtglgmvtplgrgvettwrrlidgecgirgltlddlkmksfdeetklytfdqlssk
    vaafvpygsnpgefdealwlnskavanfigyavcaadealrdaewlpteeeekertgvsi
    gggigsicdiveaaqlicekrlrrlspffipkilvnmasghvsmkygfqgpnhaavtaca
    tgahsigdatrmiqfgdadvmvaggtessidalsvagfsrsralstkfnsspqeasrpfd
    cdrdgfvigegsgvivleeyehakrrgakiyaelcgygmsgdahhitqppedgkgavlam
    tralrqsglcpnqidyvnahatstpigdavearaiktvfsehatsgtlafsstkgatghl
    lgaagaveaifsilaihhgvapmtlnvknpdpifdkrfmplttskkmlvrtamsnsfgfg
    gtnasllfasi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ix4B (B:)
    rrvvvtglgmvtplgrgvettwrrlidgecgirgltlddlkmksfdeetklytfdqlssk
    vaafvpygsnpgefdealwlnskavanfigyavcaadealrdaewlpteeeekertgvsi
    gggigsicdiveaaqlicekrlrrlspffipkilvnmasghvsmkygfqgpnhaavtaca
    tgahsigdatrmiqfgdadvmvaggtessidalsvagfsrsralstkfnsspqeasrpfd
    cdrdgfvigegsgvivleeyehakrrgakiyaelcgygmsgdahhitqppedgkgavlam
    tralrqsglcpnqidyvnahatstpigdavearaiktvfsehatsgtlafsstkgatghl
    lgaagaveaifsilaihhgvapmtlnvknpdpifdkrfmplttskkmlvrtamsnsfgfg
    gtnasllfasi