PDB entry 2ix1

View 2ix1 on RCSB PDB site
Description: RNase II D209N mutant
Class: hydrolase
Keywords: s1, RNA, csd, rnb, nuclease, RNAse II, hydrolase, RNA- binding, exonuclease
Deposited on 2006-07-05, released 2006-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exoribonuclease 2
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IX1 (Start-24)
      • engineered mutation (228)
    • Uniprot P30850 (25-End)
    Domains in SCOPe 2.08: d2ix1a1, d2ix1a2, d2ix1a3, d2ix1a4, d2ix1a5
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap *ap*ap*a)-3'
    Species: Escherichia coli BL21(DE3) [TaxId:469008]
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ix1A (A:)
    mgsshhhhhhssglvprgshmleadpllaqlkqqlhsqtpraegvvkatekgfgflevda
    qksyfipppqmkkvmhgdriiavihsekeresaepeelvepfltrfvgkvqgkndrlaiv
    pdhpllkdaipcraarglnhefkegdwavaemrrhplkgdrsfyaeltqyitfgddhfvp
    wwvtlarhnlekeapdgvatemldeglvredltaldfvtidsastedmndalfakalpdd
    klqlivaiadptawiaegskldkaakiraftnylpgfnipmlprelsddlcslranevrp
    vlacrmtlsadgtiednieffaatieskaklvydqvsdwlentgdwqpeseaiaeqvrll
    aqicqrrgewrhnhalvfkdrpdyrfilgekgevldivaeprrianriveeamiaanica
    arvlrdklgfgiynvhmgfdpanadalaallkthglhvdaeevltldgfcklrreldaqp
    tgfldsrirrfqsfaeistepgphfglgleayatwtspirkygdminhrllkavikgeta
    trpqdeitvqmaerrrlnrmaerdvgdwlyarflkdkagtdtrfaaeivdisrggmrvrl
    vdngaiafipapflhavrdelvcsqengtvqikgetvykvtdvidvtiaevrmetrsiia
    rpva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ix1A (A:)
    mleadpllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdri
    iavihsekeresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnh
    efkegdwavaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvat
    emldeglvredltaldfvtidsastedmndalfakalpddklqlivaiadptawiaegsk
    ldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednief
    faatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkd
    rpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfd
    panadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeiste
    pgphfglgleayatwtspirkygdminhrllkavikgetatrpqdeitvqmaerrrlnrm
    aerdvgdwlyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrde
    lvcsqengtvqikgetvykvtdvidvtiaevrmetrsiiarpv
    

  • Chain 'B':
    No sequence available.