PDB entry 2ix0

View 2ix0 on RCSB PDB site
Description: RNAse II
Class: hydrolase
Keywords: s1, RNA, csd, rnb, nuclease, RNAse II, hydrolase, RNA- binding, exonuclease
Deposited on 2006-07-05, released 2006-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exoribonuclease 2
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IX0 (Start-23)
    • Uniprot P30850 (24-662)
    Domains in SCOPe 2.07: d2ix0a1, d2ix0a2, d2ix0a3, d2ix0a4
  • Heterogens: C5P, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ix0A (A:)
    mgsshhhhhhssglvprgshmlddpllaqlkqqlhsqtpraegvvkatekgfgflevdaq
    ksyfipppqmkkvmhgdriiavihsekeresaepeelvepfltrfvgkvqgkndrlaivp
    dhpllkdaipcraarglnhefkegdwavaemrrhplkgdrsfyaeltqyitfgddhfvpw
    wvtlarhnlekeapdgvatemldeglvredltaldfvtidsastedmddalfakalpddk
    lqlivaiadptawiaegskldkaakiraftnylpgfnipmlprelsddlcslranevrpv
    lacrmtlsadgtiednieffaatieskaklvydqvsdwlentgdwqpeseaiaeqvrlla
    qicqrrgewrhnhalvfkdrpdyrfilgekgevldivaeprrianriveeamiaanicaa
    rvlrdklgfgiynvhmgfdpanadalaallkthglhvdaeevltldgfcklrreldaqpt
    gfldsrirrfqsfaeistepgphfglgleayatwtspirkygdminhrllkavikgetat
    rpqdeitvqmaerrrlnrmaerdvgdwlyarflkdkagtdtrfaaeivdisrggmrvrlv
    dngaiafipapflhavrdelvcsqengtvqikgetvykvtdvidvtiaevrmetrsiiar
    pva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ix0A (A:)
    ddpllaqlkqqlhsqtpraegvvkatefgflevdaqksyfipppqmkkvmhgdriiavih
    seresaepeelvepfltrfvgkvqgkndrlaivpdhpllkdaipcraarglnhefkegdw
    avaemrrhplkgdrsfyaeltqyitfgddhfvpwwvtlarhnlekeapdgvatemldegl
    vredltaldfvtidsastedmddalfakalpddklqlivaiadptawiaegskldkaaki
    raftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadgtiednieffaaties
    kaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrhnhalvfkdrpdyrfi
    lgekgevldivaeprrianriveeamiaanicaarvlrdklgfgiynvhmgfdpanadal
    aallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfqsfaeistepgphfgl
    gleayatwtspirkygdminhrllkavikgetatrpqdeitvqmaerrrlnrmaerdvgd
    wlyarflkdkagtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrdelvcsqen
    gtvqikgetvykvtdvidvtiaevrmetrsiiarpva