PDB entry 2iwg

View 2iwg on RCSB PDB site
Description: complex between the pryspry domain of trim21 and igg fc
Class: immunoglobulin domain
Keywords: zinc, RNA-binding, zinc-finger, DNA-binding, ribonucleoprotein, immunoglobulin domain, immunoglobulin c region, systemic lupus erythematosus, polymorphism, glycoprotein, metal-binding
Deposited on 2006-06-30, released 2007-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig gamma-1 chain c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iwga1, d2iwga2
  • Chain 'B':
    Compound: 52 kda ro protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IWG (0-1)
    • Uniprot P19474 (2-180)
    Domains in SCOPe 2.06: d2iwgb1
  • Chain 'D':
    Compound: ig gamma-1 chain c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iwgd1, d2iwgd2
  • Chain 'E':
    Compound: 52 kda ro protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IWG (0-1)
    • Uniprot P19474 (2-180)
    Domains in SCOPe 2.06: d2iwge_
  • Heterogens: FU4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iwgA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iwgB (B:)
    hmvhitldpdtanpwlilsedrrqvrlgdtqqsipgneerfdsypmvlgaqhfhsgkhyw
    evdvtgkeawdlgvcrdsvrrkghfllssksgfwtiwlwnkqkyeagtypqtplhlqvpp
    cqvgifldyeagmvsfynitdhgsliysfsecaftgplrpffspgfndggkntapltlcp
    l
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iwgD (D:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iwgE (E:)
    hmvhitldpdtanpwlilsedrrqvrlgdtqqsipgneerfdsypmvlgaqhfhsgkhyw
    evdvtgkeawdlgvcrdsvrrkghfllssksgfwtiwlwnkqkyeagtypqtplhlqvpp
    cqvgifldyeagmvsfynitdhgsliysfsecaftgplrpffspgfndggkntapltlcp
    l