PDB entry 2iwe

View 2iwe on RCSB PDB site
Description: structure of a cavity mutant (h117g) of pseudomonas aeruginosa azurin
Class: electron transport
Keywords: blue copper protein, redox protein, metal-binding, electron transport, azurin, transport, periplasmic
Deposited on 2006-06-29, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.194
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (116)
    Domains in SCOPe 2.07: d2iwea_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (116)
    Domains in SCOPe 2.07: d2iwed_
  • Chain 'G':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (116)
    Domains in SCOPe 2.07: d2iweg_
  • Chain 'J':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (116)
    Domains in SCOPe 2.07: d2iwej_
  • Heterogens: ZN, 2IH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iweA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpggsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iweD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpggsal
    mkgtltlk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iweG (G:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpggsal
    mkgtltlk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iweJ (J:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpggsal
    mkgtltlk