PDB entry 2iwc

View 2iwc on RCSB PDB site
Description: benzylpenicilloyl-acylated mecr1 extracellular antibiotic-sensor domain.
Class: antibiotic resistance
Keywords: bacterial antibiotic resistance, mrsa, beta-lactamase, benzylpenicillin, antibiotic resistance, methicillin resistance, beta-lactamic antibiotics, penicillin-binding protein
Deposited on 2006-06-27, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: methicillin resistance mecr1 protein
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • PDB 2IWC (0-2)
  • Uniprot P0A0B0 (3-254)
  Domains in SCOPe 2.06: d2iwca_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2iwcA (A:)
  ghmsahvqqdkyetnvsykklnqlapyfkgfdgsfvlynereqaysiynepeskqryspn
  stykiylalmafdqnllslnhteqqwdkhqypfkewnqdqnlnssmkysvnwyyenlnkh
  lrqdevksyldlieygneeisgnenywnesslkisaieqvnllknmkqhnmhfdnkaiek
  vensmtlkqkdtykyvgktgtgivnhkeangwfvgyvetkdntyyfathlkgednangek
  aqqiserilkemeli