PDB entry 2ivz

View 2ivz on RCSB PDB site
Description: structure of tolb in complex with a peptide of the colicin e9 t-domain
Class: protein transport/hydrolase
Keywords: protein transport/hydrolase, protein-protein interaction, protein transport, bacteriocin transport, tolb, colicin, plasmid, nuclease, hydrolase, transport, antibiotic, periplasmic, bacteriocin, natively disordered proteins, protein transport/hydrolase complex, endonuclease, antimicrobial, translocation
Deposited on 2006-06-23, released 2006-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tolb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IVZ
    • Uniprot P0A855 (Start-430)
    Domains in SCOPe 2.06: d2ivza1, d2ivza2
  • Chain 'B':
    Compound: protein tolb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IVZ
    • Uniprot P0A855 (Start-430)
    Domains in SCOPe 2.06: d2ivzb1, d2ivzb2
  • Chain 'C':
    Compound: protein tolb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IVZ
    • Uniprot P0A855 (Start-430)
    Domains in SCOPe 2.06: d2ivzc1, d2ivzc2
  • Chain 'D':
    Compound: protein tolb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IVZ
    • Uniprot P0A855 (Start-430)
    Domains in SCOPe 2.06: d2ivzd1, d2ivzd2
  • Chain 'E':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: colicin-e9
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ivzA (A:)
    mmkqalrvafgflilwasvlhaevrividsgvdsgrpigvvpfqwagpgaapediggiva
    adlrnsgkfnpldrarlpqqpgsaqevqpaawsalgidavvvgqvtpnpdgsynvayqlv
    dtggapgtvlaqnsykvnkqwlryaghtasdevfekltgikgafrtriayvvqtnggqfp
    yelrvsdydgynqfvvhrspqplmspawspdgsklayvtfesgrsalviqtlangavrqv
    asfprhngapafspdgsklafalsktgslnlyvmdlasgqirqvtdgrsnnteptwfpds
    qnlaftsdqagrpqvykvninggapqritwegsqnqdadvssdgkfmvmvssnggqqhia
    kqdlatggvqvlsstfldetpslapngtmviysssqgmgsvlnlvstdgrfkarlpatdg
    qvkfpawspyllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ivzA (A:)
    grpigvvpfqwapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsalgida
    vvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevfekltg
    ikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvt
    fesgrsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasg
    qirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdad
    vssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmg
    svlnlvstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ivzB (B:)
    mmkqalrvafgflilwasvlhaevrividsgvdsgrpigvvpfqwagpgaapediggiva
    adlrnsgkfnpldrarlpqqpgsaqevqpaawsalgidavvvgqvtpnpdgsynvayqlv
    dtggapgtvlaqnsykvnkqwlryaghtasdevfekltgikgafrtriayvvqtnggqfp
    yelrvsdydgynqfvvhrspqplmspawspdgsklayvtfesgrsalviqtlangavrqv
    asfprhngapafspdgsklafalsktgslnlyvmdlasgqirqvtdgrsnnteptwfpds
    qnlaftsdqagrpqvykvninggapqritwegsqnqdadvssdgkfmvmvssnggqqhia
    kqdlatggvqvlsstfldetpslapngtmviysssqgmgsvlnlvstdgrfkarlpatdg
    qvkfpawspyllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ivzB (B:)
    grpigvvpfqwapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsalgida
    vvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevfekltg
    ikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvt
    fesgrsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasg
    qirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdad
    vssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmg
    svlnlvstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ivzC (C:)
    mmkqalrvafgflilwasvlhaevrividsgvdsgrpigvvpfqwagpgaapediggiva
    adlrnsgkfnpldrarlpqqpgsaqevqpaawsalgidavvvgqvtpnpdgsynvayqlv
    dtggapgtvlaqnsykvnkqwlryaghtasdevfekltgikgafrtriayvvqtnggqfp
    yelrvsdydgynqfvvhrspqplmspawspdgsklayvtfesgrsalviqtlangavrqv
    asfprhngapafspdgsklafalsktgslnlyvmdlasgqirqvtdgrsnnteptwfpds
    qnlaftsdqagrpqvykvninggapqritwegsqnqdadvssdgkfmvmvssnggqqhia
    kqdlatggvqvlsstfldetpslapngtmviysssqgmgsvlnlvstdgrfkarlpatdg
    qvkfpawspyllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ivzC (C:)
    grpigvvpfqwapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsalgida
    vvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevfekltg
    ikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvt
    fesgrsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasg
    qirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdad
    vssdgkfmvmvssngqqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgs
    vlnlvstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ivzD (D:)
    mmkqalrvafgflilwasvlhaevrividsgvdsgrpigvvpfqwagpgaapediggiva
    adlrnsgkfnpldrarlpqqpgsaqevqpaawsalgidavvvgqvtpnpdgsynvayqlv
    dtggapgtvlaqnsykvnkqwlryaghtasdevfekltgikgafrtriayvvqtnggqfp
    yelrvsdydgynqfvvhrspqplmspawspdgsklayvtfesgrsalviqtlangavrqv
    asfprhngapafspdgsklafalsktgslnlyvmdlasgqirqvtdgrsnnteptwfpds
    qnlaftsdqagrpqvykvninggapqritwegsqnqdadvssdgkfmvmvssnggqqhia
    kqdlatggvqvlsstfldetpslapngtmviysssqgmgsvlnlvstdgrfkarlpatdg
    qvkfpawspyllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ivzD (D:)
    sgrpigvvpfqwagapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsalg
    idavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevfek
    ltgikgafrtriayvvqtfpyelrvsdydgynqfvvhrspqplmspawspdgsklayvtf
    esgrsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvmdlasgq
    irqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsqnqdadv
    ssdgkfmvmvssqhiakqdlatggvqvlsstfldetpslapngtmviysssqgmgsvlnl
    vstdgrfkarlpatdgqvkfpawspyl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.