PDB entry 2ivx

View 2ivx on RCSB PDB site
Description: crystal structure of human cyclin t2 at 1.8 a resolution (casp target)
Class: nuclear protein
Keywords: transcription regulation, cell division, phosphorylation, nuclear protein, cyclin, cell cycle, transcription
Deposited on 2006-06-21, released 2006-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-t2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60583 (0-End)
      • engineered mutation (123)
    Domains in SCOPe 2.06: d2ivxa1, d2ivxa2
  • Chain 'B':
    Compound: cyclin-t2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60583 (Start-256)
      • engineered mutation (123)
    Domains in SCOPe 2.06: d2ivxb1, d2ivxb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ivxA (A:)
    assrwfftreqlentpsrrcgveadkelscrqqaanliqemgqrlnvsqltintaivymh
    rfymhhsftkfnkniisstalflaakveeqarklehvikvahaclhpleplldtkcdayl
    qqtrelviletimlqtlgfeitiehphtdvvkctqlvraskdlaqtsyfmatnslhlttf
    clqykptviacvcihlackwsnweipvstdgkhwweyvdptvtlelldeltheflqilek
    tpnrlkkirnwranqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ivxA (A:)
    assrwfftreqlentpsrrcgveadkelscrqqaanliqemgqrlnvsqltintaivymh
    rfymhhsftkfnkniisstalflaakveeqarklehvikvahaclhpleplldtkcdayl
    qqtrelviletimlqtlgfeitiehphtdvvkctqlvraskdlaqtsyfmatnslhlttf
    clqykptviacvcihlackwsnweipvstdgkhwweyvdptvtlelldeltheflqilek
    tpnrlkkirnwranqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ivxB (B:)
    assrwfftreqlentpsrrcgveadkelscrqqaanliqemgqrlnvsqltintaivymh
    rfymhhsftkfnkniisstalflaakveeqarklehvikvahaclhpleplldtkcdayl
    qqtrelviletimlqtlgfeitiehphtdvvkctqlvraskdlaqtsyfmatnslhlttf
    clqykptviacvcihlackwsnweipvstdgkhwweyvdptvtlelldeltheflqilek
    tpnrlkkirnwranqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ivxB (B:)
    srwfftreqlentpsrrcgveadkelscrqqaanliqemgqrlnvsqltintaivymhrf
    ymhhsftkfnkniisstalflaakveeqarklehvikvahaclhpleplldtkcdaylqq
    trelviletimlqtlgfeitiehphtdvvkctqlvraskdlaqtsyfmatnslhlttfcl
    qykptviacvcihlackwsnweipvstdgkhwweyvdptvtlelldeltheflqilektp
    nrlkkirnwranqaa