PDB entry 2ivq

View 2ivq on RCSB PDB site
Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
Class: lyase
Keywords: cyanate degradation, lyase, mcsg, midwest center for structural genomics, protein structure initiative, psi
Deposited on 2006-06-14, released 2008-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqa1, d2ivqa2
  • Chain 'B':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqb1, d2ivqb2
  • Chain 'C':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqc1, d2ivqc2
  • Chain 'D':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqd1, d2ivqd2
  • Chain 'E':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqe1, d2ivqe2
  • Chain 'F':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqf1, d2ivqf2
  • Chain 'G':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqg1, d2ivqg2
  • Chain 'H':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqh1, d2ivqh2
  • Chain 'I':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqi1, d2ivqi2
  • Chain 'J':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2ivqj1, d2ivqj2
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqA (A:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqB (B:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqC (C:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqD (D:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqE (E:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqF (F:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqG (G:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqH (H:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqI (I:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivqJ (J:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmykfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf