PDB entry 2ive

View 2ive on RCSB PDB site
Description: structure of protoporphyrinogen oxidase from myxococcus xanthus
Class: oxidoreductase
Keywords: protoporphyrinogen oxidase, porphyrin biosynthesis, chlorophyll biosynthesis, fad, porphyria, flavoprotein, oxidoreductase, heme biosynthesis, haem biosynthesis
Deposited on 2006-06-13, released 2006-10-17
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protoporphyrinogen oxidase
    Species: Myxococcus xanthus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ivea1, d2ivea2
  • Chain 'B':
    Compound: protoporphyrinogen oxidase
    Species: Myxococcus xanthus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2iveb1, d2iveb2
  • Heterogens: FAD, TWN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iveA (A:)
    mdhhhhhhhhmprttgmnvavvgggisglavahhlrsrgtdavllessarlggavgthal
    agylveqgpnsfldrepatralaaalnlegriraadpaakrryvytrgrlrsvpasppaf
    lasdilplgarlrvagelfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdv
    eqlsvaatfpmlvkmerehrslilgairaqkaqrqaalpagtapklsgalstfdgglqvl
    idalaaslgdaahvgarveglaredggwrliieehgrraelsvaqvvlaapahatakllr
    plddalaalvagiayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpf
    raeggrvlyscmvggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgip
    qynlghlervaaidaalqrlpglhlignaykgvglndcirnaaqladalvagntshap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iveA (A:)
    mnvavvgggisglavahhlrsrgtdavllessarlggavgthalagylveqgpnsfldre
    patralaaalnlegriraadpaakrryvytrgrlrsvpasppaflasdilplgarlrvag
    elfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdveqlsvaatfpmlvkme
    rehrslilgairaqkaqrqagtapklsgalstfdgglqvlidalaaslgdaahvgarveg
    laredggwrliieehgrraelsvaqvvlaapahatakllrplddalaalvagiayapiav
    vhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmvggarqpg
    lveqdedalaalareelkalagvtarpsftrvfrwplgipqynlghlervaaidaalqrl
    pglhlignaykgvglndcirnaaqladalva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iveB (B:)
    mdhhhhhhhhmprttgmnvavvgggisglavahhlrsrgtdavllessarlggavgthal
    agylveqgpnsfldrepatralaaalnlegriraadpaakrryvytrgrlrsvpasppaf
    lasdilplgarlrvagelfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdv
    eqlsvaatfpmlvkmerehrslilgairaqkaqrqaalpagtapklsgalstfdgglqvl
    idalaaslgdaahvgarveglaredggwrliieehgrraelsvaqvvlaapahatakllr
    plddalaalvagiayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpf
    raeggrvlyscmvggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgip
    qynlghlervaaidaalqrlpglhlignaykgvglndcirnaaqladalvagntshap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iveB (B:)
    mnvavvgggisglavahhlrsrgtdavllessarlggavgthalagylveqgpnsfldre
    patralaaalnlegriraadpaakrryvytrgrlrsvpasppaflasdilplgarlrvag
    elfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdveqlsvaatfpmlvkme
    rehrslilgairaqkaqrqapklsgalstfdgglqvlidalaaslgdaahvgarveglar
    edggwrliieehgrraelsvaqvvlaapahatakllrplddalaalvagiayapiavvhl
    gfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmvggarqpglve
    qdedalaalareelkalagvtarpsftrvfrwplgipqynlghlervaaidaalqrlpgl
    hlignaykgvglndcirnaaqladalvagn