PDB entry 2ivd

View 2ivd on RCSB PDB site
Description: structure of protoporphyrinogen oxidase from myxococcus xanthus with acifluorfen
Class: oxidoreductase
Keywords: protoporphyrinogen oxidase, porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, haem biosynthesis, heme biosynthesis, fad, porphyria, acifluorfen, flavoprotein
Deposited on 2006-06-12, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protoporphyrinogen oxidase
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ivda1, d2ivda2
  • Chain 'B':
    Compound: protoporphyrinogen oxidase
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ivdb1, d2ivdb2
  • Heterogens: ACJ, FAD, GOL, TWN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ivdA (A:)
    mdhhhhhhhhmprttgmnvavvgggisglavahhlrsrgtdavllessarlggavgthal
    agylveqgpnsfldrepatralaaalnlegriraadpaakrryvytrgrlrsvpasppaf
    lasdilplgarlrvagelfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdv
    eqlsvaatfpmlvkmerehrslilgairaqkaqrqaalpagtapklsgalstfdgglqvl
    idalaaslgdaahvgarveglaredggwrliieehgrraelsvaqvvlaapahatakllr
    plddalaalvagiayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpf
    raeggrvlyscmvggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgip
    qynlghlervaaidaalqrlpglhlignaykgvglndcirnaaqladalvagntshap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ivdA (A:)
    mnvavvgggisglavahhlrsrgtdavllessarlggavgthalagylveqgpnsfldre
    patralaaalnlegriraadpaakrryvytrgrlrsvpasppaflasdilplgarlrvag
    elfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdveqlsvaatfpmlvkme
    rehrslilgairaqkaqrqagtapklsgalstfdgglqvlidalaaslgdaahvgarveg
    laregwrliieehgrraelsvaqvvlaapahatakllrplddalaalvagiayapiavvh
    lgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmvggarqpglv
    eqdedalaalareelkalagvtarpsftrvfrwplgipqynlghlervaaidaalqrlpg
    lhlignaykgvglndcirnaaqladalva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ivdB (B:)
    mdhhhhhhhhmprttgmnvavvgggisglavahhlrsrgtdavllessarlggavgthal
    agylveqgpnsfldrepatralaaalnlegriraadpaakrryvytrgrlrsvpasppaf
    lasdilplgarlrvagelfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdv
    eqlsvaatfpmlvkmerehrslilgairaqkaqrqaalpagtapklsgalstfdgglqvl
    idalaaslgdaahvgarveglaredggwrliieehgrraelsvaqvvlaapahatakllr
    plddalaalvagiayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpf
    raeggrvlyscmvggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgip
    qynlghlervaaidaalqrlpglhlignaykgvglndcirnaaqladalvagntshap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ivdB (B:)
    mnvavvgggisglavahhlrsrgtdavllessarlggavgthalagylveqgpnsfldre
    patralaaalnlegriraadpaakrryvytrgrlrsvpasppaflasdilplgarlrvag
    elfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdveqlsvaatfpmlvkme
    rehrslilgairaqkaqrqaklsgalstfdgglqvlidalaaslgdaahvgarveglare
    dggwrliieehgrraelsvaqvvlaapahatakllrplddalaalvagiayapiavvhlg
    fdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmvggarqpglveq
    dedalaalareelkalagvtarpsftrvfrwplgipqynlghlervaaidaalqrlpglh
    lignaykgvglndcirnaaqladalvagn