PDB entry 2ivb

View 2ivb on RCSB PDB site
Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
Class: lyase
Keywords: midwest center for structural genomics, protein structure initiative, psi, mcsg, lyase, cyanate degradation
Deposited on 2006-06-09, released 2008-10-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.148
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivba1, d2ivba2
  • Chain 'B':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbb1, d2ivbb2
  • Chain 'C':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbc1, d2ivbc2
  • Chain 'D':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbd1, d2ivbd2
  • Chain 'E':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbe1, d2ivbe2
  • Chain 'F':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbf1, d2ivbf2
  • Chain 'G':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbg1, d2ivbg2
  • Chain 'H':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbh1, d2ivbh2
  • Chain 'I':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbi1, d2ivbi2
  • Chain 'J':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d2ivbj1, d2ivbj2
  • Heterogens: SO4, CL, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbA (A:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbB (B:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbC (C:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbD (D:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbE (E:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbF (F:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbG (G:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbH (H:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbI (I:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ivbJ (J:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyrfyemlqvygttlkalvhekfgdgi
    iaainfkldvkkvadpeggeravitldgkylptkpf