PDB entry 2iv8

View 2iv8 on RCSB PDB site
Description: beta appendage in complex with b-arrestin peptide
Class: endocytosis/regulator
Keywords: endocytosis-regulator complex, sensory transduction, receptor, coated pits, adaptor complex-regulator
Deposited on 2006-06-08, released 2007-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AP-2 complex subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iv8a1, d2iv8a2
  • Chain 'P':
    Compound: beta-arrestin-1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: beta-arrestin-1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iv8A (A:)
    igmapggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnk
    nsfgvipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscl
    iplnvlfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakr
    nvegqdmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iv8A (A:)
    ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
    ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
    lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
    dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.