PDB entry 2iv8

View 2iv8 on RCSB PDB site
Description: beta appendage in complex with b-arrestin peptide
Class: endocytosis/regulator
Keywords: sensory transduction, alternative splicing, ap2, ear, arrestin, receptor, appendage, coated pits, endocytosis, phosphorylation, adaptor complex/regulator, endocytosis/regulator complex
Deposited on 2006-06-08, released 2007-06-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AP-2 complex subunit beta-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2iv8a1, d2iv8a2
  • Chain 'P':
    Compound: beta-arrestin-1
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: beta-arrestin-1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iv8A (A:)
    igmapggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnk
    nsfgvipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscl
    iplnvlfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakr
    nvegqdmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iv8A (A:)
    ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
    ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
    lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
    dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.