PDB entry 2iv7

View 2iv7 on RCSB PDB site
Description: crystal structure of waag, a glycosyltransferase involved in lipopolysaccharide biosynthesis
Class: transferase
Keywords: lipopolysaccharide biosynthesis, lps, transferase, family gt-4, glycosyltransferase
Deposited on 2006-06-08, released 2006-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipopolysaccharide core biosynthesis protein rfag
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2iv7a1
  • Heterogens: UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iv7A (A:)
    mivafclykyfpfgglqrdfmriastvaarghhvrvytqswegdcpkafeliqvpvksht
    nhgrnaeyyawvqnhlkehpadrvvgfnkmpgldvyfaadvcyaekvaqekgflyrltsr
    yrhyaaferatfeqgkstklmmltdkqiadfqkhyqteperfqilppgiypdrkyseqip
    nsreiyrqkngikeqqnlllqvgsdfgrkgvdrsiealaslpeslrhntllfvvgqdkpr
    kfealaeklgvrsnvhffsgrndvselmaaadlllhpayqeaagivlleaitaglpvltt
    avcgyahyiadancgtviaepfsqeqlnevlrkaltqsplrmawaenarhyadtqdlysl
    pekaadiitggldg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iv7A (A:)
    ivafclykyfpfgglqrdfmriastvaarghhvrvytqswegdcpkafeliqvpvkshtn
    hgrnaeyyawvqnhlkehpadrvvgfnkmpgldvyfaadvcyaekvaqekgflyrltsry
    rhyaaferatfeqgkstklmmltdkqiadfqkhyqteperfqilppgiypdrkyseqipn
    sreiyrqkngikeqqnlllqvgsdfgrkgvdrsiealaslpeslrhntllfvvgqdkprk
    fealaeklgvrsnvhffsgrndvselmaaadlllhpayqeaagivlleaitaglpvltta
    vcgyahyiadancgtviaepfsqeqlnevlrkaltqsplrmawaenarhyadtqdlyslp
    ekaadiitgg