PDB entry 2iv2

View 2iv2 on RCSB PDB site
Description: Reinterpretation of reduced form of formate dehydrogenase H from E. coli
Class: oxidoreductase
Keywords: oxidoreductase, naerobic, dehydrogenase, fe4s4, formate, iron, iron sulfur cluster, iron-sulfur, metal-binding, mgd, molybdenum, molybdopterin, molybdopterin guanine dinucleotide, mpt, nad, secys, selenium, selenocysteine
Deposited on 2006-06-08, released 2006-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.178
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: formate dehydrogenase h
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iv2x1, d2iv2x2
  • Heterogens: SF4, 2MD, MGD, MO, UNX, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2iv2X (X:)
    mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
    rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
    qkfaravigtnnvdccarvahgpsvaglhqsvgngamsnaineidntdlvfvfgynpads
    hpivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenly
    dkafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvt
    qfyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdp
    anrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafe
    dlelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwq
    iiseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgt
    sylfkekfdtpnglaqfftcdwvapidkltdeypmvlstvrevghyscrsmtgncaalaa
    ladepgyaqintedakrlgiedealvwvhsrkgkiitraqvsdrpnkgaiymtyqwwiga
    cnelvtenlspitktpeykycavrvepiadqraaeqyvideynklktrlreaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iv2X (X:)
    mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
    rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
    qkfaravigtnnvdccarvahgpsvaglhqsvgngamsnaineidntdlvfvfgynpads
    hpivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenly
    dkafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvt
    qfyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdp
    anrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafe
    dlelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwq
    iiseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgt
    sylfkekfdtpnglaqfftcdwvapidkltdeypmvlstvrevghyscrsmtgncaalaa
    ladepgyaqintedakrlgiedealvwvhsrkgkiitraqvsdrpnkgaiymtyqwwpey
    kycavrvepiadqraaeqyvideynklktrlreaala