PDB entry 2iv1

View 2iv1 on RCSB PDB site
Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
Class: lyase
Keywords: midwest center for structural genomics, protein structure initiative, psi, mcsg, lyase, cyanate degradation
Deposited on 2006-06-08, released 2008-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.14
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1a1, d2iv1a2
  • Chain 'B':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1b1, d2iv1b2
  • Chain 'C':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1c1, d2iv1c2
  • Chain 'D':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1d1, d2iv1d2
  • Chain 'E':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1e1, d2iv1e2
  • Chain 'F':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1f1, d2iv1f2
  • Chain 'G':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1g1, d2iv1g2
  • Chain 'H':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1h1, d2iv1h2
  • Chain 'I':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1i1, d2iv1i2
  • Chain 'J':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d2iv1j1, d2iv1j2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1A (A:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1B (B:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1C (C:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1D (D:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1E (E:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1F (F:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1G (G:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1H (H:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1I (I:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iv1J (J:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmyqfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf