PDB entry 2iul

View 2iul on RCSB PDB site
Description: human tace g13 mutant
Class: hydrolase
Keywords: hydrolase, phosphorylation, carboxypeptidase, metal-binding, transmembrane, metalloprotease, peptidyl dipeptidase, alternative splicing, type-I membrane-anchored protein, glycosidase, polymorphism, glycoprotein, ac, zinc, mutant, membrane, chloride, protease
Deposited on 2006-06-06, released 2006-10-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22966
      • engineered mutation (53)
      • engineered mutation (118)
      • engineered mutation (300)
      • engineered mutation (549)
    Domains in SCOPe 2.02: d2iula_
  • Heterogens: NAG, ACT, CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iulA (A:)
    lvtdeaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqiaqhtlkyg
    tqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqg
    sclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvda
    gdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllg
    nmwaqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefw
    qksmlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykd
    lpvalreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkia
    fipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhips
    svpyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpe
    amqlitgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtpnsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iulA (A:)
    deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqiaqhtlkygtqa
    rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqgscl
    qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
    wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
    aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks
    mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
    alreganpgfheaigdvlalsvstpkhlhslnllssggsdehdinflmkmaldkiafipf
    sylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpy
    iryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamql
    itgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtp