PDB entry 2iu7

View 2iu7 on RCSB PDB site
Description: site directed mutagenesis of key residues involved in the catalytic mechanism of cyanase
Class: lyase
Keywords: lyase
Deposited on 2006-05-30, released 2006-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.134
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7a1, d2iu7a2
  • Chain 'B':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7b1, d2iu7b2
  • Chain 'C':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7c1, d2iu7c2
  • Chain 'D':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7d1, d2iu7d2
  • Chain 'E':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7e1, d2iu7e2
  • Chain 'F':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7f1, d2iu7f2
  • Chain 'G':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7g1, d2iu7g2
  • Chain 'H':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7h1, d2iu7h2
  • Chain 'I':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7i1, d2iu7i2
  • Chain 'J':
    Compound: cyanate hydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00816 (0-155)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d2iu7j1, d2iu7j2
  • Heterogens: OXL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7A (A:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7B (B:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7C (C:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7D (D:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7E (E:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7F (F:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7G (G:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7H (H:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7I (I:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iu7J (J:)
    miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
    vgakldldedsilllqmiplrgciddriptdptmfrfyemlqvygttlkalvhekfgdgi
    isainfkldvkkvadpeggeravitldgkylptkpf