PDB entry 2iu6

View 2iu6 on RCSB PDB site
Description: regulation of the dha operon of lactococcus lactis
Class: transferase
Keywords: kinase, dihydroxyacetone kinase transferase, transferase
Deposited on 2006-05-27, released 2006-06-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroxyacetone kinase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IU6 (328-End)
    • Uniprot Q9CIW0 (13-327)
    Domains in SCOPe 2.03: d2iu6a_
  • Chain 'B':
    Compound: dihydroxyacetone kinase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IU6 (328-End)
    • Uniprot Q9CIW0 (13-327)
    Domains in SCOPe 2.03: d2iu6b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iu6A (A:)
    mefynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvg
    yvgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikeart
    egidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslsp
    eiytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklk
    aeinwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdm
    sgisltlcsvkdpkwldylnvptgafawlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iu6A (A:)
    efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy
    vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte
    gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe
    iytlgvalevsfgigihgepgyrvekfegseriaielvnklkaeinwqkkanknyillvn
    glgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdmsgisltlcsvkdpkwldy
    lnvptgafawlehhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iu6B (B:)
    mefynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvg
    yvgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikeart
    egidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslsp
    eiytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklk
    aeinwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdm
    sgisltlcsvkdpkwldylnvptgafawlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iu6B (B:)
    efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy
    vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte
    gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe
    iytlgvalapvdevsfgigihgepgyrvekfegseriaielvnklkaeinwqkkanknyi
    llvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdmsgisltlcsvkdpk
    wldylnvptgafawlehhhhh