PDB entry 2iu4

View 2iu4 on RCSB PDB site
Description: dihydroxyacetone kinase operon co-activator dha-dhaq
Class: transferase
Keywords: transferase, lactococcus lactis, dihydroxyacetone, co-activator, kinase
Deposited on 2006-05-27, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroxyacetone kinase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IU4 (328-End)
    • Uniprot Q9CIW0 (13-327)
    Domains in SCOPe 2.07: d2iu4a1, d2iu4a2
  • Chain 'B':
    Compound: dihydroxyacetone kinase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IU4 (328-End)
    • Uniprot Q9CIW0 (13-327)
    Domains in SCOPe 2.07: d2iu4b1, d2iu4b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iu4A (A:)
    mefynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvg
    yvgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikeart
    egidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslsp
    eiytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklk
    aeinwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdm
    sgisltlcsvkdpkwldylnvptgafawlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iu4A (A:)
    neipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgyvgsgml
    aaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikeartegidvry
    ivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspeiytlgv
    alapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklkaeinwqk
    kanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdmsgisltl
    csvkdpkwldylnvptgafawlehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iu4B (B:)
    mefynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvg
    yvgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikeart
    egidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslsp
    eiytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklk
    aeinwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdm
    sgisltlcsvkdpkwldylnvptgafawlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iu4B (B:)
    efynstneipeemlkgidltypqltylpetgilydntynektvpiisgggsghepahvgy
    vgsgmlaaavtgplfippksknilkairqvnsgkgvfviiknfeadlkefneaikearte
    gidvryivshddisvnaynfhkrhrgvagtillhkilgafakeggsideieqlalslspe
    iytlgvalapvhfphqktsfvlaedevsfgigihgepgyrvekfegseriaielvnklka
    einwqkkanknyillvnglgsttlmelysfqydvmrlleleglsvkfckvgnlmtscdms
    gisltlcsvkdpkwldylnvptgafawlehh