PDB entry 2ity

View 2ity on RCSB PDB site
Description: Crystal structure of EGFR kinase domain in complex with Iressa
Class: transferase
Keywords: receptor, cell cycle, ATP-binding, transferase, transmembrane, phosphorylation, disease mutation, glycoprotein, anti-oncogene, nucleotide- binding, iressa, egfr, zd1839, membrane tyrosine-protein kinase, epidermal growth factor
Deposited on 2006-05-25, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 3.42 Å
R-factor: 0.216
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2itya1
  • Heterogens: IRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ityA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
    nfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ityA (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaevpikwmalesi
    lhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymi
    mvkcwmidadsrpkfreliiefskmardpqrylviqgdermhldeedmddvvdadeylip