PDB entry 2itv

View 2itv on RCSB PDB site
Description: crystal structure of egfr kinase domain l858r mutation in complex with amp-pnp
Class: transferase
Keywords: receptor, cell cycle, ATP-binding, transferase, transmembrane, phosphorylation, disease mutation, polymorphism, glycoprotein, anti-oncogene, nucleotide-binding, alternative splicing, anp, egfr, l858r, kinase, amp-pnp, membrane, tyrosine-protein kinase, epidermal growth factor
Deposited on 2006-05-25, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (0-End)
      • engineered mutation (162)
    Domains in SCOPe 2.06: d2itva_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2itvA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
    nfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2itvA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeevpikwmale
    silhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvy
    mimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlmdeedmddvvdadey
    lip