PDB entry 2itq

View 2itq on RCSB PDB site
Description: Crystal structure of EGFR kinase domain G719S mutation in complex with AFN941
Class: transferase
Keywords: receptor, cell cycle, ATP-binding, transferase, transmembrane, phosphorylation, disease mutation, glycoprotein, anti-oncogene, nucleotide-binding, afn941, egfr, g719s, staurosporine, membrane, tyrosine-protein kinase, epidermal growth factor
Deposited on 2006-05-25, released 2007-04-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (23)
    Domains in SCOPe 2.04: d2itqa_
  • Heterogens: ITQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2itqA (A:)
    geapnqallrilketefkkikvlssgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
    nfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2itqA (A:)
    eapnqallrilketefkkikvlssgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
    pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
    pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdmddvvdadeyli