PDB entry 2itl

View 2itl on RCSB PDB site
Description: The origin binding domain of the SV40 large T antigen bound to the functional pen palindrome DNA (23 bp)
Class: DNA binding protein/DNA
Keywords: DNA binding protein
Deposited on 2006-10-19, released 2006-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: Simian Virus 40
    Gene: large T antigen
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2itla1
  • Chain 'B':
    Compound: large t antigen
    Species: Simian Virus 40
    Gene: large T antigen
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2itlb1
  • Chain 'C':
    Compound: 24-nt PEN element of the SV40 DNA origin
  • Chain 'W':
    Compound: 24-nt PEN element of the SV40 DNA origin
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2itlA (A:)
    gshmkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisr
    hnsynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsviee
    slpgglkehdfnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2itlA (A:)
    dpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynhn
    ilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpgglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2itlB (B:)
    gshmkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisr
    hnsynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsviee
    slpgglkehdfnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2itlB (B:)
    pkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynhni
    lffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslp
    

  • Chain 'C':
    No sequence available.

  • Chain 'W':
    No sequence available.