PDB entry 2itf

View 2itf on RCSB PDB site
Description: Crystal structure IsdA NEAT domain from Staphylococcus aureus with heme bound
Class: metal binding protein
Keywords: NEAT domain, heme, iron
Deposited on 2006-10-19, released 2006-12-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-regulated surface determinant protein A
    Species: Staphylococcus aureus
    Gene: isdA, frpA, stbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A152 (Start-126)
      • modified residue (26)
      • modified residue (30)
    Domains in SCOP 1.75: d2itfa1
  • Chain 'B':
    Compound: Iron-regulated surface determinant protein A
    Species: Staphylococcus aureus
    Gene: isdA, frpA, stbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A152 (Start-126)
      • modified residue (26)
      • modified residue (30)
    Domains in SCOP 1.75: d2itfb1
  • Chain 'C':
    Compound: Iron-regulated surface determinant protein A
    Species: Staphylococcus aureus
    Gene: isdA, frpA, stbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A152 (Start-126)
      • modified residue (26)
      • modified residue (30)
    Domains in SCOP 1.75: d2itfc1
  • Chain 'D':
    Compound: Iron-regulated surface determinant protein A
    Species: Staphylococcus aureus
    Gene: isdA, frpA, stbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A152 (4-126)
      • modified residue (26)
      • modified residue (30)
    Domains in SCOP 1.75: d2itfd1
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2itfA (A:)
    gshmsqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeyk
    fynannqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefe
    kaiptla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2itfA (A:)
    atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
    qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2itfB (B:)
    gshmsqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeyk
    fynannqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefe
    kaiptla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2itfB (B:)
    atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
    qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2itfC (C:)
    gshmsqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeyk
    fynannqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefe
    kaiptla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2itfC (C:)
    atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
    qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
    a
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2itfD (D:)
    gshmsqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeyk
    fynannqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefe
    kaiptla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2itfD (D:)
    sqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfyna
    nnqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaip
    tla