PDB entry 2ite

View 2ite on RCSB PDB site
Description: Crystal structure of the IsdA NEAT domain from Staphylococcus aureus
Class: metal binding protein
Keywords: NEAT domain, heme, iron, METAL BINDING PROTEIN
Deposited on 2006-10-19, released 2006-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-regulated surface determinant protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: isdA, frpA, stbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A152 (Start-126)
      • modified residue (26)
      • modified residue (30)
    Domains in SCOPe 2.08: d2itea1
  • Chain 'B':
    Compound: Iron-regulated surface determinant protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: isdA, frpA, stbA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A152 (Start-126)
      • modified residue (26)
      • modified residue (30)
    Domains in SCOPe 2.08: d2iteb_
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iteA (A:)
    gshmsqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeyk
    fynannqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefe
    kaiptla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iteA (A:)
    atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
    qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iteB (B:)
    gshmsqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeyk
    fynannqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefe
    kaiptla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iteB (B:)
    atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
    qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
    a