PDB entry 2itd

View 2itd on RCSB PDB site
Description: Potassium Channel KcsA-Fab complex in Barium Chloride
Class: membrane protein
Keywords: Voltage-gated channel, Transmembrane, Ionic channel, Ion transport, 3D-structure, K Channel, protein-antibody Fab complex
Deposited on 2006-10-19, released 2007-05-15
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment heavy chain
    Species: MUS MUSCULUS
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: MUS MUSCULUS
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered (89)
    Domains in SCOP 1.73: d2itdc1
  • Heterogens: BA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2itdC (C:)
mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrgh

    Sequence, based on observed residues (ATOM records): (download) 
    >2itdC (C:)
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh