PDB entry 2itc

View 2itc on RCSB PDB site
Description: Potassium Channel KcsA-Fab complex in Sodium Chloride
Class: membrane protein
Keywords: Voltage-gated channel, Transmembrane, Ionic channel, Ion transport, K Channel, protein-antibody Fab complex, MEMBRANE PROTEIN
Deposited on 2006-10-19, released 2007-05-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.246
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ITC (0-218)
  • Chain 'B':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ITC (0-211)
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered (89)
    Domains in SCOPe 2.02: d2itcc1
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2itcC (C:)
mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrgh

    Sequence, based on observed residues (ATOM records): (download) 
    >2itcC (C:)
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh